PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g05320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 603aa    MW: 67847.3 Da    PI: 6.7053
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g05320.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.35.5e-26366418356
         G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     +++WtpeLH++Fv+aveqL  +++A+P++ilelmkv+gLt+++v+SHLQkYR++
  Vang11g05320.1 366 QVDWTPELHKKFVKAVEQL-SIDQAIPSRILELMKVEGLTRHNVASHLQKYRMH 418
                     579****************.9*******************************96 PP

2Response_reg26.24e-101102241109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHT....TTSEEEEEESTTT.HHHHH CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireee....pklpiivvtahge.eedal 87 
                     vl+ +++ + +  +r  le  +y +v ++ d  eal  +  +   +++ ++ ++ +    G+++l++ +  +      +   vvt+++   +++ 
  Vang11g05320.1 110 VLLLEEDSISAAEIRAKLEAMDY-NVSTFCDENEALSAISSRPesFHIAIVEVSSSSsQGGFKFLENAKDLPtimiFPTS-HVVTSNNHcLNTMM 202
                     7899999999999**********.***************666666***********977999**9999999965432222.3556556569**** PP

                     HHHHTTESEEEESS--HHHHHH CS
    Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                     +++ +Ga +flsKp ++++l++
  Vang11g05320.1 203 KCIALGAVEFLSKPLSEDKLRN 224
                     *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.42E-14106232IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.5E-15106261No hitNo description
SMARTSM004480.0086108226IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011022.926109230IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.9E-7110225IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.66E-8111229No hitNo description
TIGRFAMsTIGR015578.0E-23366418IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.1E-25366421IPR009057Homeodomain-like
SuperFamilySSF466891.29E-16367421IPR009057Homeodomain-like
PfamPF002493.7E-6368416IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MPSLFIGLTD MNSLPDPSFG VKSSSFVLLS SAESAMRYLG CKWRVFDSGF RRKFFLKKLV  60
SWKCSAFSVG YLGAVYHLNK IELRNDAKPA MVFTANDLQE WKDFPKGLKV LLLEEDSISA  120
AEIRAKLEAM DYNVSTFCDE NEALSAISSR PESFHIAIVE VSSSSSQGGF KFLENAKDLP  180
TIMIFPTSHV VTSNNHCLNT MMKCIALGAV EFLSKPLSED KLRNIWQHVV HKAFSSGTSI  240
LCESLKPVKE SLVTMLQLPT DNEQHESRVS IDIEKVSRFT DNDDVLSPGN DKYPAPSTPQ  300
LMHGTRLLDD GDCQEQTNCS TEKESGEHDG ESKSVETTCD NIAETERNLG SSLSTELQFW  360
YLFWSQVDWT PELHKKFVKA VEQLSIDQAI PSRILELMKV EGLTRHNVAS HLQKYRMHRR  420
QIFPKEEDRK WLNQRERSYC VQRPIMAFPP YHSNHTHTMA PIYPKWGQPS TQTAGMHMWS  480
TPGYPLWQPT AEHWHWKPFP GMHADAWGCP VLPVPPPQAP FPYSKNMPAL LNADATGHTF  540
TMPQSSLENY PAEEVVDKVV KEAVSKPWLP LPLGLKPPST DSVLTELSRQ GICSIPPRSS  600
KG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-14366422763ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550939.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-132APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0L9TPU60.0A0A0L9TPU6_PHAAN; Uncharacterized protein
STRINGGLYMA17G16360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-123ARR-B family protein